| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
| Family a.43.1.1: Arc/Mnt-like phage repressors [47599] (2 proteins) |
| Protein Arc repressor [47600] (1 species) |
| Species Salmonella bacteriophage P22 [TaxId:10754] [47601] (11 PDB entries) |
| Domain d1bdtd_: 1bdt D: [17436] protein/DNA complex |
PDB Entry: 1bdt (more details), 2.5 Å
SCOPe Domain Sequences for d1bdtd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bdtd_ a.43.1.1 (D:) Arc repressor {Salmonella bacteriophage P22 [TaxId: 10754]}
mkgmskmpqfnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegr
Timeline for d1bdtd_: