Lineage for d1bdtc_ (1bdt C:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3582Fold a.43: Met repressor-like [47597] (1 superfamily)
  4. 3583Superfamily a.43.1: Met repressor-like [47598] (2 families) (S)
  5. 3584Family a.43.1.1: Phage repressors [47599] (2 proteins)
  6. 3585Protein Arc repressor [47600] (1 species)
  7. 3586Species Salmonella bacteriophage p22 [TaxId:10754] [47601] (10 PDB entries)
  8. 3601Domain d1bdtc_: 1bdt C: [17435]

Details for d1bdtc_

PDB Entry: 1bdt (more details), 2.5 Å

PDB Description: wild type gene-regulating protein arc/dna complex

SCOP Domain Sequences for d1bdtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdtc_ a.43.1.1 (C:) Arc repressor {Salmonella bacteriophage p22}
mkgmskmpqfnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegr

SCOP Domain Coordinates for d1bdtc_:

Click to download the PDB-style file with coordinates for d1bdtc_.
(The format of our PDB-style files is described here.)

Timeline for d1bdtc_: