SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3dxsx_ (3dxs X:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2176148Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2176276Family d.58.17.0: automated matches [191590] (1 protein)
    not a true family
  6. 2176277Protein automated matches [191063] (7 species)
    not a true protein
  7. 2176302Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188959] (1 PDB entry)
  8. 2176303Domain d3dxsx_: 3dxs X: [174335]
    automated match to d1fvqa_
    complexed with li, zn

Details for d3dxsx_

PDB Entry: 3dxs (more details), 1.7 Å

PDB Description: Crystal structure of a copper binding domain from HMA7, a P-type ATPase
PDB Compounds: (X:) Copper-transporting ATPase RAN1

SCOPe Domain Sequences for d3dxsx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dxsx_ d.58.17.0 (X:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mrkiqvgvtgmtcaacsnsveaalmnvngvfkasvallqnradvvfdpnlvkeedikeei
edagfeaeilaeew

SCOPe Domain Coordinates for d3dxsx_:

Click to download the PDB-style file with coordinates for d3dxsx_.
(The format of our PDB-style files is described here.)

Timeline for d3dxsx_: