Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d3dxsx_ (3dxs X:)

  1. Root: SCOP 1.75B
  2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. Family d.58.17.0: automated matches [191590] (1 protein)
    not a true family
  6. Protein automated matches [191063] (2 species)
    not a true protein
  7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188959] (1 PDB entry)
  8. Domain d3dxsx_: 3dxs X: [174335]
    automated match to d1fvqa_
    complexed with li, zn

Details for d3dxsx_

PDB Entry: 3dxs (more details)
PDB Description: crystal structure of a copper binding domain from hma7, a p- type atpase
PDB Compounds: (X:) Copper-transporting ATPase RAN1

SCOP Domain Sequences for d3dxsx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dxsx_ d.58.17.0 (X:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mrkiqvgvtgmtcaacsnsveaalmnvngvfkasvallqnradvvfdpnlvkeedikeei
edagfeaeilaeew

SCOP Domain Coordinates for d3dxsx_:

Click to download the PDB-style file with coordinates for d3dxsx_.
(The format of our PDB-style files is described here.)

Timeline for d3dxsx_:

d3dxsx_ appears in SCOP 1.75A


d3dxsx_
(click for larger image)


d3dxsx_ in context of chain

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu