Lineage for d1bdta_ (1bdt A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998574Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 1998575Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 1998576Family a.43.1.1: Arc/Mnt-like phage repressors [47599] (2 proteins)
  6. 1998577Protein Arc repressor [47600] (1 species)
  7. 1998578Species Salmonella bacteriophage P22 [TaxId:10754] [47601] (11 PDB entries)
  8. 1998591Domain d1bdta_: 1bdt A: [17433]
    protein/DNA complex

Details for d1bdta_

PDB Entry: 1bdt (more details), 2.5 Å

PDB Description: wild type gene-regulating protein arc/dna complex
PDB Compounds: (A:) protein (gene-regulating protein arc)

SCOPe Domain Sequences for d1bdta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdta_ a.43.1.1 (A:) Arc repressor {Salmonella bacteriophage P22 [TaxId: 10754]}
mkgmskmpqfnlrwprevldlvrkvaeengrsvnseiyqrvmesfkkegrig

SCOPe Domain Coordinates for d1bdta_:

Click to download the PDB-style file with coordinates for d1bdta_.
(The format of our PDB-style files is described here.)

Timeline for d1bdta_: