Lineage for d3dxec_ (3dxe C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1323359Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1323360Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1323920Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 1323921Protein automated matches [190052] (4 species)
    not a true protein
  7. 1323936Species Human (Homo sapiens) [TaxId:9606] [186914] (10 PDB entries)
  8. 1323939Domain d3dxec_: 3dxe C: [174322]
    automated match to d1wgua_
    mutant

Details for d3dxec_

PDB Entry: 3dxe (more details), 2 Å

PDB Description: crystal structure of the intracellular domain of human app (t668a mutant) in complex with fe65-ptb2
PDB Compounds: (C:) Amyloid beta A4 protein-binding family B member 1

SCOPe Domain Sequences for d3dxec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dxec_ b.55.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nelvqkfqvyylgnvpvakpvgvdvingalesvlssssreqwtpshvsvapatltilhqq
teavlgecrvrflsflavgrdvhtfafimaagpasfcchmfwcepnaaslseavqaacml
ryqkcldars

SCOPe Domain Coordinates for d3dxec_:

Click to download the PDB-style file with coordinates for d3dxec_.
(The format of our PDB-style files is described here.)

Timeline for d3dxec_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3dxea_