Lineage for d1mylf_ (1myl F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712590Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 2712591Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 2712592Family a.43.1.1: Arc/Mnt-like phage repressors [47599] (2 proteins)
  6. 2712593Protein Arc repressor [47600] (1 species)
  7. 2712594Species Salmonella bacteriophage P22 [TaxId:10754] [47601] (11 PDB entries)
  8. 2712606Domain d1mylf_: 1myl F: [17432]

Details for d1mylf_

PDB Entry: 1myl (more details), 2.4 Å

PDB Description: substituting hydrophobic residues for a buried salt bridge enhances protein stability but does not reduce conformational specificity
PDB Compounds: (F:) arc repressor

SCOPe Domain Sequences for d1mylf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mylf_ a.43.1.1 (F:) Arc repressor {Salmonella bacteriophage P22 [TaxId: 10754]}
mpqfnlrwprevldlvrkvaeengmsvnsyiyqlvmesfk

SCOPe Domain Coordinates for d1mylf_:

Click to download the PDB-style file with coordinates for d1mylf_.
(The format of our PDB-style files is described here.)

Timeline for d1mylf_: