SCOPe 2.08: Domain d3dxca_: 3dxc A:

Lineage for d3dxca_ (3dxc A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)

8. Domain d3dxca_: 3dxc A: [174317]
   automated match to d1wgua_

Details for d3dxca_

PDB Entry: 3dxc, 2.1 Å

PDB Description: crystal structure of the intracellular domain of human app in complex with fe65-ptb2

PDB Compounds: (A:) Amyloid beta A4 protein-binding family B member 1

SCOPe Domain Sequences for d3dxca_:

Sequence; same for both SEQRES and ATOM records:

>d3dxca_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nelvqkfqvyylgnvpvakpvgvdvingalesvlssssreqwtpshvsvapatltilhqq
teavlgecrvrflsflavgrdvhtfafimaagpasfcchmfwcepnaaslseavqaacml
ryqkcldars

Timeline for d3dxca_:

• d3dxca_ first appeared in SCOPe 2.01
  
• d3dxca_ appears in SCOPe 2.07