Lineage for d3dwib_ (3dwi B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2480698Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2480699Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2481051Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2481052Protein automated matches [190215] (33 species)
    not a true protein
  7. 2481152Species Mycobacterium tuberculosis [TaxId:83332] [188609] (9 PDB entries)
  8. 2481166Domain d3dwib_: 3dwi B: [174308]
    automated match to d2bhsa1
    complexed with plp, so4

Details for d3dwib_

PDB Entry: 3dwi (more details), 2.81 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis CysM, the cysteine synthase B
PDB Compounds: (B:) Cysteine synthase B

SCOPe Domain Sequences for d3dwib_:

Sequence, based on SEQRES records: (download)

>d3dwib_ c.79.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mtrydsllqalgntplvglqrlsprwddgrdgphvrlwakledrnptgsikdrpavrmie
qaeadgllrpgatileptsgntgislamaarlkgyrlicvmpentsverrqllelygaqi
ifsaaeggsntavatakelaatnpswvmlyqygnpantdshycgtgpelladlpeithfv
aglgttgtlmgtgrflrehvanvaivaaeprygegvyalrnmdegfvpelydpeiltary
svgavdavrrtrelvhtegifagistgavlhaalgvgagalaageradialvvadagwky
lstgayagsldd

Sequence, based on observed residues (ATOM records): (download)

>d3dwib_ c.79.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mtrydsllqalgntplvglqrlsprwddgrdgphvrlwakledrnptgsikdrpavrmie
qaeadgllrpgatileptsgntgislamaarlkgyrlicvmpentsverrqllelygaqi
ifsaasntavatakelaatnpswvmlyqygnpantdshycgtgpelladlpeithfvagl
gttgtlmgtgrflrehvanvaivaaeprygegvyalrnmdegfvpelydpeiltarysvg
avdavrrtrelvhtegifagistgavlhaalgvgagalaageradialvvadagwkylst
gayagsldd

SCOPe Domain Coordinates for d3dwib_:

Click to download the PDB-style file with coordinates for d3dwib_.
(The format of our PDB-style files is described here.)

Timeline for d3dwib_: