Lineage for d3dwia_ (3dwi A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2140083Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2140084Protein automated matches [190215] (32 species)
    not a true protein
  7. 2140153Species Mycobacterium tuberculosis [TaxId:83332] [188609] (9 PDB entries)
  8. 2140156Domain d3dwia_: 3dwi A: [174307]
    automated match to d2bhsa1
    complexed with plp, so4

Details for d3dwia_

PDB Entry: 3dwi (more details), 2.81 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis CysM, the cysteine synthase B
PDB Compounds: (A:) Cysteine synthase B

SCOPe Domain Sequences for d3dwia_:

Sequence, based on SEQRES records: (download)

>d3dwia_ c.79.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mtrydsllqalgntplvglqrlsprwddgrdgphvrlwakledrnptgsikdrpavrmie
qaeadgllrpgatileptsgntgislamaarlkgyrlicvmpentsverrqllelygaqi
ifsaaeggsntavatakelaatnpswvmlyqygnpantdshycgtgpelladlpeithfv
aglgttgtlmgtgrflrehvanvaivaaeprygegvyalrnmdegfvpelydpeiltary
svgavdavrrtrelvhtegifagistgavlhaalgvgagalaageradialvvadagwky
lstgayagslddae

Sequence, based on observed residues (ATOM records): (download)

>d3dwia_ c.79.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mtrydsllqalgntplvglqrlsprwddgrdgphvrlwakledrnptgsikdrpavrmie
qaeadgllrpgatileptsgntgislamaarlkgyrlicvmpentsverrqllelygaqi
ifsaggsntavatakelaatnpswvmlyqygnpantdshycgtgpelladlpeithfvag
lgttgtlmgtgrflrehvanvaivaaeprvpelydpeiltarysvgavdavrrtrelvht
egifagistgavlhaalgvgagalaageradialvvadagwkylstgayagslddae

SCOPe Domain Coordinates for d3dwia_:

Click to download the PDB-style file with coordinates for d3dwia_.
(The format of our PDB-style files is described here.)

Timeline for d3dwia_: