![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
![]() | Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species) |
![]() | Species Guinea pig (Cavia porcellus) [TaxId:10141] [117425] (4 PDB entries) Uniprot Q6QLL4 23-296 |
![]() | Domain d3dwfd_: 3dwf D: [174304] automated match to d1xsea_ complexed with gol, nap, so4; mutant |
PDB Entry: 3dwf (more details), 2.2 Å
SCOPe Domain Sequences for d3dwfd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dwfd_ c.2.1.2 (D:) 11-beta-hydroxysteroid dehydrogenase 1 {Guinea pig (Cavia porcellus) [TaxId: 10141]} ekfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelgaa sahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevnf hsfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflvn kvnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrwv pyllgnpgrkimeelsaaeynwdnvlsneklygrw
Timeline for d3dwfd_: