Lineage for d3dwfa1 (3dwf A:25-293)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2449763Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 2449764Species Guinea pig (Cavia porcellus) [TaxId:10141] [117425] (4 PDB entries)
    Uniprot Q6QLL4 23-296
  8. 2449769Domain d3dwfa1: 3dwf A:25-293 [174301]
    automated match to d1xsea_
    complexed with gol, nap, so4; mutant

Details for d3dwfa1

PDB Entry: 3dwf (more details), 2.2 Å

PDB Description: crystal structure of the guinea pig 11beta-hydroxysteroid dehydrogenase type 1 mutant f278e
PDB Compounds: (A:) 11-beta-hydroxysteroid dehydrogenase 1

SCOPe Domain Sequences for d3dwfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dwfa1 c.2.1.2 (A:25-293) 11-beta-hydroxysteroid dehydrogenase 1 {Guinea pig (Cavia porcellus) [TaxId: 10141]}
ekfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelgaa
sahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevnf
hsfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflvn
kvnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrwv
pyllgnpgrkimeelsaaeynwdnvlsne

SCOPe Domain Coordinates for d3dwfa1:

Click to download the PDB-style file with coordinates for d3dwfa1.
(The format of our PDB-style files is described here.)

Timeline for d3dwfa1: