Lineage for d3dvtf_ (3dvt F:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1024356Fold d.39: DLC [54647] (1 superfamily)
    core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342
  4. 1024357Superfamily d.39.1: DLC [54648] (1 family) (S)
  5. 1024358Family d.39.1.1: DLC [54649] (3 proteins)
    8 kDa dynein light chain, DLC8
  6. 1024359Protein Dynein light chain 1 (DLC1) [54650] (3 species)
    synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase
  7. 1024360Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102918] (8 PDB entries)
  8. 1024371Domain d3dvtf_: 3dvt F: [174296]
    automated match to d1rhwa_

Details for d3dvtf_

PDB Entry: 3dvt (more details), 2.3 Å

PDB Description: Biochemical and structural characterization of the PAK1- LC8 interaction
PDB Compounds: (F:) Dynein light chain 1, cytoplasmic

SCOPe Domain Sequences for d3dvtf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dvtf_ d.39.1.1 (F:) Dynein light chain 1 (DLC1) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfg
syvthetrhfiyfylgqvaillfksg

SCOPe Domain Coordinates for d3dvtf_:

Click to download the PDB-style file with coordinates for d3dvtf_.
(The format of our PDB-style files is described here.)

Timeline for d3dvtf_: