SCOPe 2.02: Domain d3dvte_: 3dvt E:

Lineage for d3dvte_ (3dvt E:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.39: DLC [54647] (1 superfamily)
   core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342

4. Superfamily d.39.1: DLC [54648] (1 family)

5. Family d.39.1.1: DLC [54649] (3 proteins)
   8 kDa dynein light chain, DLC8

6. Protein Dynein light chain 1 (DLC1) [54650] (3 species)
   synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102918] (8 PDB entries)

8. Domain d3dvte_: 3dvt E: [174295]
   automated match to d1rhwa_

Details for d3dvte_

PDB Entry: 3dvt, 2.3 Å

PDB Description: Biochemical and structural characterization of the PAK1- LC8 interaction

PDB Compounds: (E:) Dynein light chain 1, cytoplasmic

SCOPe Domain Sequences for d3dvte_:

Sequence; same for both SEQRES and ATOM records:

>d3dvte_ d.39.1.1 (E:) Dynein light chain 1 (DLC1) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfg
syvthetrhfiyfylgqvaillfksg

Timeline for d3dvte_:

• d3dvte_ first appeared in SCOPe 2.01
  
• d3dvte_ appears in SCOPe 2.03
  
• d3dvte_ appears in the current release, SCOPe 2.08