Lineage for d3dvrx_ (3dvr X:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 990724Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 990725Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 990726Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 990896Protein automated matches [190073] (9 species)
    not a true protein
  7. 990953Species Tritirachium album [TaxId:37998] [187258] (13 PDB entries)
  8. 990963Domain d3dvrx_: 3dvr X: [174289]
    automated match to d1bjre_
    complexed with ca

Details for d3dvrx_

PDB Entry: 3dvr (more details), 1.02 Å

PDB Description: Proteinase K by LB nanotemplate method after the first step of high X-Ray dose on ESRF ID14-2 beamline
PDB Compounds: (X:) Proteinase K

SCOPe Domain Sequences for d3dvrx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dvrx_ c.41.1.1 (X:) automated matches {Tritirachium album [TaxId: 37998]}
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtsilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa

SCOPe Domain Coordinates for d3dvrx_:

Click to download the PDB-style file with coordinates for d3dvrx_.
(The format of our PDB-style files is described here.)

Timeline for d3dvrx_: