SCOPe 2.08: Domain d3dvpb_: 3dvp B:

Lineage for d3dvpb_ (3dvp B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.39: DLC [54647] (1 superfamily)
   core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342

4. Superfamily d.39.1: DLC [54648] (1 family)
   automatically mapped to Pfam PF01221

5. Family d.39.1.1: DLC [54649] (3 proteins)
   8 kDa dynein light chain, DLC8

6. Protein Dynein light chain 1 (DLC1) [54650] (3 species)
   synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102918] (14 PDB entries)

8. Domain d3dvpb_: 3dvp B: [174287]
   automated match to d1rhwa_

Details for d3dvpb_

PDB Entry: 3dvp, 2.5 Å

PDB Description: pak1 peptide bound lc8

PDB Compounds: (B:) Dynein light chain 1, cytoplasmic

SCOPe Domain Sequences for d3dvpb_:

Sequence; same for both SEQRES and ATOM records:

>d3dvpb_ d.39.1.1 (B:) Dynein light chain 1 (DLC1) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kaviknadmseemqqdavdcatqalekyniepdiaayikkefdkkynptwhcivgrnfgs
yvthetrhfiyfylgqvaillfksg

Timeline for d3dvpb_:

• d3dvpb_ first appeared in SCOPe 2.01
  
• d3dvpb_ appears in SCOPe 2.07