Lineage for d1mylb_ (1myl B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3582Fold a.43: Met repressor-like [47597] (1 superfamily)
  4. 3583Superfamily a.43.1: Met repressor-like [47598] (2 families) (S)
  5. 3584Family a.43.1.1: Phage repressors [47599] (2 proteins)
  6. 3585Protein Arc repressor [47600] (1 species)
  7. 3586Species Salmonella bacteriophage p22 [TaxId:10754] [47601] (10 PDB entries)
  8. 3594Domain d1mylb_: 1myl B: [17428]

Details for d1mylb_

PDB Entry: 1myl (more details), 2.4 Å

PDB Description: substituting hydrophobic residues for a buried salt bridge enhances protein stability but does not reduce conformational specificity

SCOP Domain Sequences for d1mylb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mylb_ a.43.1.1 (B:) Arc repressor {Salmonella bacteriophage p22}
mpqfnlrwprevldlvrkvaeengmsvnsyiyqlvmesfk

SCOP Domain Coordinates for d1mylb_:

Click to download the PDB-style file with coordinates for d1mylb_.
(The format of our PDB-style files is described here.)

Timeline for d1mylb_: