SCOPe 2.07: Domain d3dvag_: 3dva G:

Lineage for d3dvag_ (3dva G:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins)
   parent family to TK and PFOR
   heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module

6. Protein automated matches [190098] (3 species)
   not a true protein

7. Species Bacillus stearothermophilus [TaxId:1422] [188729] (3 PDB entries)

8. Domain d3dvag_: 3dva G: [174274]
   Other proteins in same PDB: d3dvab1, d3dvab2, d3dvad1, d3dvad2, d3dvaf1, d3dvaf2, d3dvah1, d3dvah2, d3dvai_, d3dvaj_
   automated match to d1w85a_
   complexed with k, mg, tpw

Details for d3dvag_

PDB Entry: 3dva, 2.35 Å

PDB Description: snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex

PDB Compounds: (G:) Pyruvate dehydrogenase E1 component subunit alpha

SCOPe Domain Sequences for d3dvag_:

Sequence; same for both SEQRES and ATOM records:

>d3dvag_ c.36.1.11 (G:) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
tfqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrildqrs
islnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqaflfsr
ghfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgdfye
ginfagafkapaifvvqnnrfaastpvekqtvaktlaqkavaagipgiqvdgmdplavya
avkaareraingegptlietlcfrygphtmsgddptryrskelenewakkdplvrfrkfl
eakglwseeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqyeiyk
ekesk

Timeline for d3dvag_:

• d3dvag_ first appeared in SCOPe 2.01
  
• d3dvag_ appears in SCOPe 2.06
  
• d3dvag_ appears in the current release, SCOPe 2.08