![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module |
![]() | Protein automated matches [190098] (3 species) not a true protein |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [188729] (3 PDB entries) |
![]() | Domain d3dvag_: 3dva G: [174274] Other proteins in same PDB: d3dvab1, d3dvab2, d3dvad1, d3dvad2, d3dvaf1, d3dvaf2, d3dvah1, d3dvah2, d3dvai_, d3dvaj_ automated match to d1w85a_ complexed with k, mg, tpw |
PDB Entry: 3dva (more details), 2.35 Å
SCOPe Domain Sequences for d3dvag_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dvag_ c.36.1.11 (G:) automated matches {Bacillus stearothermophilus [TaxId: 1422]} tfqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrildqrs islnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqaflfsr ghfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgdfye ginfagafkapaifvvqnnrfaastpvekqtvaktlaqkavaagipgiqvdgmdplavya avkaareraingegptlietlcfrygphtmsgddptryrskelenewakkdplvrfrkfl eakglwseeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqyeiyk ekesk
Timeline for d3dvag_: