Lineage for d3dvaa_ (3dva A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1844143Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1844144Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1844608Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 1844687Protein automated matches [190098] (3 species)
    not a true protein
  7. 1844688Species Bacillus stearothermophilus [TaxId:1422] [188729] (3 PDB entries)
  8. 1844689Domain d3dvaa_: 3dva A: [174271]
    Other proteins in same PDB: d3dvab1, d3dvab2, d3dvad1, d3dvad2, d3dvaf1, d3dvaf2, d3dvah1, d3dvah2, d3dvai_, d3dvaj_
    automated match to d1w85a_
    complexed with k, mg, tpw

Details for d3dvaa_

PDB Entry: 3dva (more details), 2.35 Å

PDB Description: snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex
PDB Compounds: (A:) Pyruvate dehydrogenase E1 component subunit alpha

SCOPe Domain Sequences for d3dvaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dvaa_ c.36.1.11 (A:) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
tfqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrildqrs
islnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqaflfsr
ghfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgdfye
ginfagafkapaifvvqnnrfaastpvekqtvaktlaqkavaagipgiqvdgmdplavya
avkaareraingegptlietlcfrygphtmsgddptryrskelenewakkdplvrfrkfl
eakglwseeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqyeiyk
ekesk

SCOPe Domain Coordinates for d3dvaa_:

Click to download the PDB-style file with coordinates for d3dvaa_.
(The format of our PDB-style files is described here.)

Timeline for d3dvaa_: