SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3dvaa_ (3dva A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108258Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2108259Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2108723Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 protein domains)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 2108802Protein automated matches [190098] (3 species)
    not a true protein
  7. 2108803Species Bacillus stearothermophilus [TaxId:1422] [188729] (3 PDB entries)
  8. 2108804Domain d3dvaa_: 3dva A: [174271]
    Other proteins in same PDB: d3dvab1, d3dvab2, d3dvad1, d3dvad2, d3dvaf1, d3dvaf2, d3dvah1, d3dvah2, d3dvai_, d3dvaj_
    automated match to d1w85a_
    complexed with k, mg, tpw

Details for d3dvaa_

PDB Entry: 3dva (more details), 2.35 Å

PDB Description: Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multi-enzyme complex
PDB Compounds: (A:) Pyruvate dehydrogenase E1 component subunit alpha

SCOPe Domain Sequences for d3dvaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dvaa_ c.36.1.11 (A:) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
tfqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrildqrs
islnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqaflfsr
ghfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgdfye
ginfagafkapaifvvqnnrfaastpvekqtvaktlaqkavaagipgiqvdgmdplavya
avkaareraingegptlietlcfrygphtmsgddptryrskelenewakkdplvrfrkfl
eakglwseeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqyeiyk
ekesk

SCOPe Domain Coordinates for d3dvaa_:

Click to download the PDB-style file with coordinates for d3dvaa_.
(The format of our PDB-style files is described here.)

Timeline for d3dvaa_: