![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
![]() | Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species) |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188506] (4 PDB entries) |
![]() | Domain d3dv2d_: 3dv2 D: [174265] automated match to d1kama_ complexed with so4 |
PDB Entry: 3dv2 (more details), 2.3 Å
SCOPe Domain Sequences for d3dv2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dv2d_ c.26.1.3 (D:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrnitsvesrlqml elateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwynie alldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvy iernglyes
Timeline for d3dv2d_: