Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module |
Protein automated matches [190098] (3 species) not a true protein |
Species Bacillus stearothermophilus [TaxId:1422] [188729] (3 PDB entries) |
Domain d3dv0g_: 3dv0 G: [174258] Other proteins in same PDB: d3dv0b1, d3dv0b2, d3dv0d1, d3dv0d2, d3dv0f1, d3dv0f2, d3dv0h1, d3dv0h2, d3dv0i_, d3dv0j_ automated match to d1w85a_ complexed with k, mg, pyr, tpw |
PDB Entry: 3dv0 (more details), 2.5 Å
SCOPe Domain Sequences for d3dv0g_:
Sequence, based on SEQRES records: (download)
>d3dv0g_ c.36.1.11 (G:) automated matches {Bacillus stearothermophilus [TaxId: 1422]} tfqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrildqrs islnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqaflfsr ghfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgdfye ginfagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdplavya avkaareraingegptlietlcfrygphtmsgddptryrskelenewakkdplvrfrkfl eakglwseeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqyeiyk ekes
>d3dv0g_ c.36.1.11 (G:) automated matches {Bacillus stearothermophilus [TaxId: 1422]} tfqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrildqrs islnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqaflfsr ghfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgdfye ginfagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdplavya avkaareraingegptlietlcfrygphtdptnewakkdplvrfrkfleakglwseeeen nvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqyeiykekes
Timeline for d3dv0g_: