Lineage for d3duvb_ (3duv B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1001844Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1001845Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1002257Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)
  6. 1002338Protein automated matches [190992] (5 species)
    not a true protein
  7. 1002351Species Haemophilus influenzae [TaxId:727] [188698] (1 PDB entry)
  8. 1002353Domain d3duvb_: 3duv B: [174251]
    automated match to d1vica_
    complexed with kdo, p4c

Details for d3duvb_

PDB Entry: 3duv (more details), 2.3 Å

PDB Description: crystal structure of 3-deoxy-manno-octulosonate cytidylyltransferase from haemophilus influenzae complexed with the substrate 3-deoxy- manno-octulosonate in the-configuration
PDB Compounds: (B:) 3-deoxy-manno-octulosonate cytidylyltransferase

SCOPe Domain Sequences for d3duvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3duvb_ c.68.1.13 (B:) automated matches {Haemophilus influenzae [TaxId: 727]}
msftviiparfassrlpgkpladikgkpmiqhvfekalqsgasrviiatdnenvadvaks
fgaevcmtsvnhnsgterlaevveklaipdneiivniqgdeplippvivrqvadnlakfn
vnmaslavkihdaeelfnpnavkvltdkdgyvlyfsrsvipydrdqfmnlqdvqkvqlsd
aylrhigiyayragfikqyvqwaptqlenlekleqlrvlyngerihvelakevpavgvdt
aedlekvrailaan

SCOPe Domain Coordinates for d3duvb_:

Click to download the PDB-style file with coordinates for d3duvb_.
(The format of our PDB-style files is described here.)

Timeline for d3duvb_: