SCOPe 2.08: Domain d3duvb_: 3duv B:

Lineage for d3duvb_ (3duv B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)

6. Protein automated matches [190992] (6 species)
   not a true protein

7. Species Haemophilus influenzae [TaxId:727] [188698] (1 PDB entry)

8. Domain d3duvb_: 3duv B: [174251]
   automated match to d1vica_
   complexed with kdo, p4c

Details for d3duvb_

PDB Entry: 3duv, 2.3 Å

PDB Description: crystal structure of 3-deoxy-manno-octulosonate cytidylyltransferase from haemophilus influenzae complexed with the substrate 3-deoxy- manno-octulosonate in the-configuration

PDB Compounds: (B:) 3-deoxy-manno-octulosonate cytidylyltransferase

SCOPe Domain Sequences for d3duvb_:

Sequence; same for both SEQRES and ATOM records:

>d3duvb_ c.68.1.13 (B:) automated matches {Haemophilus influenzae [TaxId: 727]}
msftviiparfassrlpgkpladikgkpmiqhvfekalqsgasrviiatdnenvadvaks
fgaevcmtsvnhnsgterlaevveklaipdneiivniqgdeplippvivrqvadnlakfn
vnmaslavkihdaeelfnpnavkvltdkdgyvlyfsrsvipydrdqfmnlqdvqkvqlsd
aylrhigiyayragfikqyvqwaptqlenlekleqlrvlyngerihvelakevpavgvdt
aedlekvrailaan

Timeline for d3duvb_:

• d3duvb_ first appeared in SCOPe 2.01
  
• d3duvb_ appears in SCOPe 2.07