| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Hemoglobin, beta-chain [46500] (26 species) |
| Species Human (Homo sapiens) [TaxId:9606] [46501] (289 PDB entries) Uniprot P68871 |
| Domain d3dutb_: 3dut B: [174247] Other proteins in same PDB: d3duta_, d3dutc_ automated match to d1nqpb_ complexed with hem, po4 |
PDB Entry: 3dut (more details), 1.55 Å
SCOPe Domain Sequences for d3dutb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dutb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
vhltpeeksavtalwgkvnvdevggkalgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh
Timeline for d3dutb_: