SCOPe 2.08: Domain d3dukf1: 3duk F:1-124

Lineage for d3dukf1 (3duk F:1-124)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (35 species)
   not a true protein

7. Species Methylobacillus flagellatus [TaxId:265072] [188697] (1 PDB entry)

8. Domain d3dukf1: 3duk F:1-124 [174243]
   Other proteins in same PDB: d3duka2, d3dukb2, d3dukc2, d3dukd2, d3duke2, d3dukf2
   automated match to d3blza1
   complexed with cl, edo

Details for d3dukf1

PDB Entry: 3duk, 2.2 Å

PDB Description: crystal structure of a ntf2-like protein of unknown function (mfla_0564) from methylobacillus flagellatus kt at 2.200 a resolution

PDB Compounds: (F:) NTF2-like protein of unknown function

SCOPe Domain Sequences for d3dukf1:

Sequence; same for both SEQRES and ATOM records:

>d3dukf1 d.17.4.0 (F:1-124) automated matches {Methylobacillus flagellatus [TaxId: 265072]}
msvkvsvddidgitevlnvymnaaesgtgeemsaafhkdatifgyvgdklafngpikdly
dwhnsngpaknvqsritnidivgtvaharveaenwtnfkfsdlflllkldgkwtivnkvf
hlha

Timeline for d3dukf1:

• d3dukf1 first appeared in SCOPe 2.01, called d3dukf_
  
• d3dukf1 appears in SCOPe 2.07