Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
Protein automated matches [190205] (26 species) not a true protein |
Species Methylobacillus flagellatus [TaxId:265072] [188697] (1 PDB entry) |
Domain d3duke1: 3duk E:1-124 [174242] Other proteins in same PDB: d3duka2, d3dukb2, d3dukc2, d3dukd2, d3duke2, d3dukf2 automated match to d3blza1 complexed with cl, edo |
PDB Entry: 3duk (more details), 2.2 Å
SCOPe Domain Sequences for d3duke1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3duke1 d.17.4.0 (E:1-124) automated matches {Methylobacillus flagellatus [TaxId: 265072]} msvkvsvddidgitevlnvymnaaesgtgeemsaafhkdatifgyvgdklafngpikdly dwhnsngpaknvqsritnidivgtvaharveaenwtnfkfsdlflllkldgkwtivnkvf hlha
Timeline for d3duke1: