Lineage for d3duke1 (3duk E:1-124)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180921Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2181455Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2182288Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2182289Protein automated matches [190205] (26 species)
    not a true protein
  7. 2182345Species Methylobacillus flagellatus [TaxId:265072] [188697] (1 PDB entry)
  8. 2182350Domain d3duke1: 3duk E:1-124 [174242]
    Other proteins in same PDB: d3duka2, d3dukb2, d3dukc2, d3dukd2, d3duke2, d3dukf2
    automated match to d3blza1
    complexed with cl, edo

Details for d3duke1

PDB Entry: 3duk (more details), 2.2 Å

PDB Description: crystal structure of a ntf2-like protein of unknown function (mfla_0564) from methylobacillus flagellatus kt at 2.200 a resolution
PDB Compounds: (E:) NTF2-like protein of unknown function

SCOPe Domain Sequences for d3duke1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3duke1 d.17.4.0 (E:1-124) automated matches {Methylobacillus flagellatus [TaxId: 265072]}
msvkvsvddidgitevlnvymnaaesgtgeemsaafhkdatifgyvgdklafngpikdly
dwhnsngpaknvqsritnidivgtvaharveaenwtnfkfsdlflllkldgkwtivnkvf
hlha

SCOPe Domain Coordinates for d3duke1:

Click to download the PDB-style file with coordinates for d3duke1.
(The format of our PDB-style files is described here.)

Timeline for d3duke1: