Lineage for d3dukd_ (3duk D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404616Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1405093Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1405776Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 1405777Protein automated matches [190205] (13 species)
    not a true protein
  7. 1405796Species Methylobacillus flagellatus [TaxId:265072] [188697] (1 PDB entry)
  8. 1405800Domain d3dukd_: 3duk D: [174241]
    automated match to d3blza1
    complexed with cl, edo

Details for d3dukd_

PDB Entry: 3duk (more details), 2.2 Å

PDB Description: crystal structure of a ntf2-like protein of unknown function (mfla_0564) from methylobacillus flagellatus kt at 2.200 a resolution
PDB Compounds: (D:) NTF2-like protein of unknown function

SCOPe Domain Sequences for d3dukd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dukd_ d.17.4.0 (D:) automated matches {Methylobacillus flagellatus [TaxId: 265072]}
gmsvkvsvddidgitevlnvymnaaesgtgeemsaafhkdatifgyvgdklafngpikdl
ydwhnsngpaknvqsritnidivgtvaharveaenwtnfkfsdlflllkldgkwtivnkv
fhlha

SCOPe Domain Coordinates for d3dukd_:

Click to download the PDB-style file with coordinates for d3dukd_.
(The format of our PDB-style files is described here.)

Timeline for d3dukd_: