Lineage for d1bazd_ (1baz D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735385Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 1735386Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 1735387Family a.43.1.1: Arc/Mnt-like phage repressors [47599] (2 proteins)
  6. 1735388Protein Arc repressor [47600] (1 species)
  7. 1735389Species Salmonella bacteriophage P22 [TaxId:10754] [47601] (11 PDB entries)
  8. 1735393Domain d1bazd_: 1baz D: [17424]
    mutant

Details for d1bazd_

PDB Entry: 1baz (more details), 1.9 Å

PDB Description: arc repressor mutant phe10val
PDB Compounds: (D:) arc repressor

SCOPe Domain Sequences for d1bazd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bazd_ a.43.1.1 (D:) Arc repressor {Salmonella bacteriophage P22 [TaxId: 10754]}
mpqvnlrwprevldlvrkvaeengrsvnseiyqrvmesfk

SCOPe Domain Coordinates for d1bazd_:

Click to download the PDB-style file with coordinates for d1bazd_.
(The format of our PDB-style files is described here.)

Timeline for d1bazd_: