SCOPe 2.07: Domain d3duib_: 3dui B:

Lineage for d3duib_ (3dui B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein automated matches [190029] (5 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [188930] (1 PDB entry)

8. Domain d3duib_: 3dui B: [174237]
   automated match to d1slaa_
   complexed with bme

Details for d3duib_

PDB Entry: 3dui, 2.1 Å

PDB Description: Crystal structure of the oxidized CG-1B: an adhesion/growth-regulatory lectin from chicken

PDB Compounds: (B:) beta-galactoside-binding lectin

SCOPe Domain Sequences for d3duib_:

Sequence; same for both SEQRES and ATOM records:

>d3duib_ b.29.1.3 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
qgpvctnlglkpgqrltvkgiiapnaksfvmnlgkdsthlglhfnprfdahgdvnlivcn
skkmeewgteqretvfpfqkgapieitfsinpsdltvhlpghqfsfpnrlglsvfdyfdt
hgdftlrsvswe

Timeline for d3duib_:

• d3duib_ first appeared in SCOPe 2.01
  
• d3duib_ appears in SCOPe 2.06
  
• d3duib_ appears in the current release, SCOPe 2.08