Lineage for d3duib_ (3dui B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779190Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2779456Protein automated matches [190029] (6 species)
    not a true protein
  7. 2779457Species Chicken (Gallus gallus) [TaxId:9031] [188930] (1 PDB entry)
  8. 2779459Domain d3duib_: 3dui B: [174237]
    automated match to d1slaa_
    complexed with bme

Details for d3duib_

PDB Entry: 3dui (more details), 2.1 Å

PDB Description: Crystal structure of the oxidized CG-1B: an adhesion/growth-regulatory lectin from chicken
PDB Compounds: (B:) beta-galactoside-binding lectin

SCOPe Domain Sequences for d3duib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3duib_ b.29.1.3 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
qgpvctnlglkpgqrltvkgiiapnaksfvmnlgkdsthlglhfnprfdahgdvnlivcn
skkmeewgteqretvfpfqkgapieitfsinpsdltvhlpghqfsfpnrlglsvfdyfdt
hgdftlrsvswe

SCOPe Domain Coordinates for d3duib_:

Click to download the PDB-style file with coordinates for d3duib_.
(The format of our PDB-style files is described here.)

Timeline for d3duib_: