| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
| Protein automated matches [190029] (6 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [188930] (1 PDB entry) |
| Domain d3duib_: 3dui B: [174237] automated match to d1slaa_ complexed with bme |
PDB Entry: 3dui (more details), 2.1 Å
SCOPe Domain Sequences for d3duib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3duib_ b.29.1.3 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
qgpvctnlglkpgqrltvkgiiapnaksfvmnlgkdsthlglhfnprfdahgdvnlivcn
skkmeewgteqretvfpfqkgapieitfsinpsdltvhlpghqfsfpnrlglsvfdyfdt
hgdftlrsvswe
Timeline for d3duib_: