Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
Protein automated matches [190029] (4 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [188930] (1 PDB entry) |
Domain d3duia_: 3dui A: [174236] automated match to d1slaa_ complexed with bme |
PDB Entry: 3dui (more details), 2.1 Å
SCOPe Domain Sequences for d3duia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3duia_ b.29.1.3 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} qgpvctnlglkpgqrltvkgiiapnaksfvmnlgkdsthlglhfnprfdahgdvnlivcn skkmeewgteqretvfpfqkgapieitfsinpsdltvhlpghqfsfpnrlglsvfdyfdt hgdftlrsvswe
Timeline for d3duia_: