| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module |
| Protein automated matches [190098] (3 species) not a true protein |
| Species Bacillus stearothermophilus [TaxId:1422] [188729] (3 PDB entries) |
| Domain d3dufe_: 3duf E: [174234] Other proteins in same PDB: d3dufb1, d3dufb2, d3dufd1, d3dufd2, d3duff1, d3duff2, d3dufh1, d3dufh2, d3dufi_, d3dufj_ automated match to d1w85a_ complexed with k, mg, r1t |
PDB Entry: 3duf (more details), 2.5 Å
SCOPe Domain Sequences for d3dufe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dufe_ c.36.1.11 (E:) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
tfqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrildqrs
islnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqaflfsr
ghfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgdfye
ginfagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdplavya
avkaareraingegptlietlcfrygphtmsgddptryrskelenewakkdplvrfrkfl
eakglwseeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqyeiyk
ekesk
Timeline for d3dufe_: