Lineage for d3dufe_ (3duf E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2865076Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 2865155Protein automated matches [190098] (3 species)
    not a true protein
  7. 2865156Species Bacillus stearothermophilus [TaxId:1422] [188729] (3 PDB entries)
  8. 2865167Domain d3dufe_: 3duf E: [174234]
    Other proteins in same PDB: d3dufb1, d3dufb2, d3dufd1, d3dufd2, d3duff1, d3duff2, d3dufh1, d3dufh2, d3dufi_, d3dufj_
    automated match to d1w85a_
    complexed with k, mg, r1t

Details for d3dufe_

PDB Entry: 3duf (more details), 2.5 Å

PDB Description: Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multi-enzyme complex
PDB Compounds: (E:) Pyruvate dehydrogenase E1 component subunit alpha

SCOPe Domain Sequences for d3dufe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dufe_ c.36.1.11 (E:) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
tfqfpfaeqlekvaeqfptfqilneegevvneeampelsdeqlkelmrrmvytrildqrs
islnrqgrlgfyaptagqeasqiashfalekedfilpgyrdvpqiiwhglplyqaflfsr
ghfhgnqipegvnvlppqiiigaqyiqaagvalglkmrgkkavaitytgdggtsqgdfye
ginfagafkapaifvvqnnrfaistpvekqtvaktlaqkavaagipgiqvdgmdplavya
avkaareraingegptlietlcfrygphtmsgddptryrskelenewakkdplvrfrkfl
eakglwseeeennvieqakeeikeaikkadetpkqkvtdlisimfeelpfnlkeqyeiyk
ekesk

SCOPe Domain Coordinates for d3dufe_:

Click to download the PDB-style file with coordinates for d3dufe_.
(The format of our PDB-style files is described here.)

Timeline for d3dufe_: