SCOPe 2.01: Domain d3du3l_: 3du3 L:

Lineage for d3du3l_ (3du3 L:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (45 PDB entries)
   Uniprot P02954

8. Domain d3du3l_: 3du3 L: [174228]
   Other proteins in same PDB: d3du3m_
   automated match to d1k6nl_
   complexed with bcl, bph, cdl, fe, lda, spn, u10; mutant

Details for d3du3l_

PDB Entry: 3du3, 2.8 Å

PDB Description: e(l212)a, d(l213)a, a(m249)y triple mutant structure of photosynthetic reaction center

PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d3du3l_:

Sequence; same for both SEQRES and ATOM records:

>d3du3l_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhaatffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d3du3l_:

• d3du3l_ is new in SCOPe 2.01-stable
  
• d3du3l_ appears in SCOPe 2.02
  
• d3du3l_ appears in the current release, SCOPe 2.08