Lineage for d3dtwb_ (3dtw B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983234Protein Vascular endothelial growth factor receptor 2 (kdr) [56160] (1 species)
    PTK group; PDGFR/VEGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2983235Species Human (Homo sapiens) [TaxId:9606] [56161] (30 PDB entries)
  8. 2983274Domain d3dtwb_: 3dtw B: [174224]
    Other proteins in same PDB: d3dtwa2
    automated match to d1vr2a_
    complexed with a96

Details for d3dtwb_

PDB Entry: 3dtw (more details), 2.9 Å

PDB Description: crystal structure of the vegfr2 kinase domain in complex with a benzisoxazole inhibitor
PDB Compounds: (B:) Vascular endothelial growth factor receptor 2

SCOPe Domain Sequences for d3dtwb_:

Sequence, based on SEQRES records: (download)

>d3dtwb_ d.144.1.7 (B:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
lpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkegathseh
ralmselkilihighhlnvvnllgactkpggplmvitefckfgnlstylrskrnefvpyk
vapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfgl
ardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgaspypgv
kideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllqa

Sequence, based on observed residues (ATOM records): (download)

>d3dtwb_ d.144.1.7 (B:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
lpydaskwefprdrlklgkplgrgqvieadafgidktatcrtvavkmlathsehralmse
lkilihighhlnvvnllgactkpggplmvitefckfgnlstylrskrnefvpykykdflt
lehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfglrlplkwmapeti
fdrvytiqsdvwsfgvllweifslgaspypgvkideefcrrlkegtrmrapdyttpemyq
tmldcwhgepsqrptfselvehlgnllqa

SCOPe Domain Coordinates for d3dtwb_:

Click to download the PDB-style file with coordinates for d3dtwb_.
(The format of our PDB-style files is described here.)

Timeline for d3dtwb_: