Lineage for d1bazb_ (1baz B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325749Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 2325750Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 2325751Family a.43.1.1: Arc/Mnt-like phage repressors [47599] (2 proteins)
  6. 2325752Protein Arc repressor [47600] (1 species)
  7. 2325753Species Salmonella bacteriophage P22 [TaxId:10754] [47601] (11 PDB entries)
  8. 2325755Domain d1bazb_: 1baz B: [17422]
    mutant

Details for d1bazb_

PDB Entry: 1baz (more details), 1.9 Å

PDB Description: arc repressor mutant phe10val
PDB Compounds: (B:) arc repressor

SCOPe Domain Sequences for d1bazb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bazb_ a.43.1.1 (B:) Arc repressor {Salmonella bacteriophage P22 [TaxId: 10754]}
kmpqvnlrwprevldlvrkvaeengrsvnseiyqrvmesfk

SCOPe Domain Coordinates for d1bazb_:

Click to download the PDB-style file with coordinates for d1bazb_.
(The format of our PDB-style files is described here.)

Timeline for d1bazb_: