Lineage for d1bazb_ (1baz B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47945Fold a.43: Met repressor-like [47597] (1 superfamily)
  4. 47946Superfamily a.43.1: Met repressor-like [47598] (2 families) (S)
  5. 47947Family a.43.1.1: Phage repressors [47599] (2 proteins)
  6. 47948Protein Arc repressor [47600] (1 species)
  7. 47949Species Salmonella bacteriophage p22 [TaxId:10754] [47601] (10 PDB entries)
  8. 47951Domain d1bazb_: 1baz B: [17422]

Details for d1bazb_

PDB Entry: 1baz (more details), 1.9 Å

PDB Description: arc repressor mutant phe10val

SCOP Domain Sequences for d1bazb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bazb_ a.43.1.1 (B:) Arc repressor {Salmonella bacteriophage p22}
kmpqvnlrwprevldlvrkvaeengrsvnseiyqrvmesfk

SCOP Domain Coordinates for d1bazb_:

Click to download the PDB-style file with coordinates for d1bazb_.
(The format of our PDB-style files is described here.)

Timeline for d1bazb_: