Lineage for d3dsnf_ (3dsn F:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1300526Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1300679Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1300684Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1300809Protein automated matches [190569] (7 species)
    not a true protein
  7. 1300836Species Yersinia pestis [TaxId:632] [188957] (3 PDB entries)
  8. 1300842Domain d3dsnf_: 3dsn F: [174215]
    Other proteins in same PDB: d3dsna1, d3dsna2, d3dsnd1, d3dsnd2
    automated match to d1p5ub_
    mutant

Details for d3dsnf_

PDB Entry: 3dsn (more details), 2.2 Å

PDB Description: Crystal structure of the complex of the Caf1M chaperone with the mini-fiber of two Caf1 subunits (Caf1:Caf1), carrying the Thr7Phe mutation in the Gd donor strand
PDB Compounds: (F:) F1 capsule antigen

SCOPe Domain Sequences for d3dsnf_:

Sequence, based on SEQRES records: (download)

>d3dsnf_ b.2.3.2 (F:) automated matches {Yersinia pestis [TaxId: 632]}
itltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltftsqd
gnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggklaagky
tdavtvtvsnq

Sequence, based on observed residues (ATOM records): (download)

>d3dsnf_ b.2.3.2 (F:) automated matches {Yersinia pestis [TaxId: 632]}
itltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltftsqd
gnnhqfttkvigkdsrdfdispkvngengddvvlatgsqdffvrsigskggklaagkytd
avtvtvsnq

SCOPe Domain Coordinates for d3dsnf_:

Click to download the PDB-style file with coordinates for d3dsnf_.
(The format of our PDB-style files is described here.)

Timeline for d3dsnf_: