SCOPe 2.03: Domain d3dsne_: 3dsn E:

Lineage for d3dsne_ (3dsn E:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (9 proteins)

6. Protein automated matches [190569] (7 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [188957] (3 PDB entries)

8. Domain d3dsne_: 3dsn E: [174214]
   Other proteins in same PDB: d3dsna1, d3dsna2, d3dsnd1, d3dsnd2
   automated match to d1p5ub_
   mutant

Details for d3dsne_

PDB Entry: 3dsn, 2.2 Å

PDB Description: Crystal structure of the complex of the Caf1M chaperone with the mini-fiber of two Caf1 subunits (Caf1:Caf1), carrying the Thr7Phe mutation in the Gd donor strand

PDB Compounds: (E:) F1 capsule antigen

SCOPe Domain Sequences for d3dsne_:

Sequence; same for both SEQRES and ATOM records:

>d3dsne_ b.2.3.2 (E:) automated matches {Yersinia pestis [TaxId: 632]}
adltasftatatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
ffvrsigskggklaagkytdavtvtvsnq

Timeline for d3dsne_:

• d3dsne_ first appeared in SCOPe 2.01
  
• d3dsne_ appears in SCOPe 2.02
  
• d3dsne_ appears in SCOPe 2.04
  
• d3dsne_ appears in the current release, SCOPe 2.08