Lineage for d3dsnc_ (3dsn C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1112569Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1112704Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1112709Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1112822Protein automated matches [190569] (5 species)
    not a true protein
  7. 1112840Species Yersinia pestis [TaxId:632] [188957] (3 PDB entries)
  8. 1112844Domain d3dsnc_: 3dsn C: [174213]
    automated match to d1p5ub_
    mutant

Details for d3dsnc_

PDB Entry: 3dsn (more details), 2.2 Å

PDB Description: Crystal structure of the complex of the Caf1M chaperone with the mini-fiber of two Caf1 subunits (Caf1:Caf1), carrying the Thr7Phe mutation in the Gd donor strand
PDB Compounds: (C:) F1 capsule antigen

SCOPe Domain Sequences for d3dsnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dsnc_ b.2.3.2 (C:) automated matches {Yersinia pestis [TaxId: 632]}
ritltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltftsq
dgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggklaagk
ytdavtvtvsnq

SCOPe Domain Coordinates for d3dsnc_:

Click to download the PDB-style file with coordinates for d3dsnc_.
(The format of our PDB-style files is described here.)

Timeline for d3dsnc_: