SCOPe 2.05: Domain d3dsdb_: 3dsd B:

Lineage for d3dsdb_ (3dsd B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.4: DNA double-strand break repair nuclease [64427] (1 protein)
   contains C-terminal alpha/beta subdomain

6. Protein Mre11 [64428] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [64429] (5 PDB entries)
   Uniprot Q8U1N9

8. Domain d3dsdb_: 3dsd B: [174211]
   automated match to d1ii7a_
   protein/DNA complex; complexed with mn

Details for d3dsdb_

PDB Entry: 3dsd, 2.2 Å

PDB Description: crystal structure of p. furiosus mre11-h85s bound to a branched dna and manganese

PDB Compounds: (B:) DNA double-strand break repair protein mre11

SCOPe Domain Sequences for d3dsdb_:

Sequence; same for both SEQRES and ATOM records:

>d3dsdb_ d.159.1.4 (B:) Mre11 {Pyrococcus furiosus [TaxId: 2261]}
mkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhssrpspgt
lkkaiallqipkehsipvfaiegnsdrtqrgpsvlnlledfglvyvigmrkekveneylt
serlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhqgvrevs
eargedyfeiglgdlpegylyyalghihkryetsysgspvvypgslerwdfgdyevryew
dgikfkerygvnkgfyivedfkprfveikvrpfidvkikgseeeirkaikrliplipkna
yvrlnigwrkpfdlteikellnveylkidtwri

Timeline for d3dsdb_:

• d3dsdb_ first appeared in SCOPe 2.01
  
• d3dsdb_ appears in SCOPe 2.04
  
• d3dsdb_ appears in SCOPe 2.06
  
• d3dsdb_ appears in the current release, SCOPe 2.08