![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
![]() | Family d.159.1.4: DNA double-strand break repair nuclease [64427] (1 protein) contains C-terminal alpha/beta subdomain |
![]() | Protein Mre11 [64428] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [64429] (4 PDB entries) Uniprot Q8U1N9 |
![]() | Domain d3dsda_: 3dsd A: [174210] automated match to d1ii7a_ protein/DNA complex; complexed with mn |
PDB Entry: 3dsd (more details), 2.2 Å
SCOPe Domain Sequences for d3dsda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dsda_ d.159.1.4 (A:) Mre11 {Pyrococcus furiosus [TaxId: 2261]} mkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhssrpspgt lkkaiallqipkehsipvfaiegnsdrtqrgpsvlnlledfglvyvigmrkekveneylt serlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhqgvrevs eargedyfeiglgdlpegylyyalghihkryetsysgspvvypgslerwdfgdyevryew dgikfkerygvnkgfyivedfkprfveikvrpfidvkikgseeeirkaikrliplipkna yvrlnigwrkpfdlteikellnveylkidtwri
Timeline for d3dsda_: