SCOPe 2.08: Domain d3drnb_: 3drn B:

Lineage for d3drnb_ (3drn B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [188853] (4 PDB entries)

8. Domain d3drnb_: 3drn B: [174209]
   automated match to d2a4va1
   complexed with cit, gol

Details for d3drnb_

PDB Entry: 3drn, 2.15 Å

PDB Description: the crystal structure of bcp1 from sulfolobus sulfataricus

PDB Compounds: (B:) Peroxiredoxin, bacterioferritin comigratory protein homolog

SCOPe Domain Sequences for d3drnb_:

Sequence; same for both SEQRES and ATOM records:

>d3drnb_ c.47.1.0 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
vkvgdkaplfegiadngekislsdyigkhnivlyfypkddtpgstreasafrdnwdllkd
ydvvvigvssddinshkrfkekyklpfilvsdpdkkirelygakgfilparitfvidkkg
iirhiynsqmnpanhvnealkalkqikeee

Timeline for d3drnb_:

• d3drnb_ first appeared in SCOPe 2.01
  
• d3drnb_ appears in SCOPe 2.07