Lineage for d3drnb_ (3drn B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880360Species Sulfolobus solfataricus [TaxId:2287] [188853] (4 PDB entries)
  8. 2880366Domain d3drnb_: 3drn B: [174209]
    automated match to d2a4va1
    complexed with cit, gol

Details for d3drnb_

PDB Entry: 3drn (more details), 2.15 Å

PDB Description: the crystal structure of bcp1 from sulfolobus sulfataricus
PDB Compounds: (B:) Peroxiredoxin, bacterioferritin comigratory protein homolog

SCOPe Domain Sequences for d3drnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3drnb_ c.47.1.0 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
vkvgdkaplfegiadngekislsdyigkhnivlyfypkddtpgstreasafrdnwdllkd
ydvvvigvssddinshkrfkekyklpfilvsdpdkkirelygakgfilparitfvidkkg
iirhiynsqmnpanhvnealkalkqikeee

SCOPe Domain Coordinates for d3drnb_:

Click to download the PDB-style file with coordinates for d3drnb_.
(The format of our PDB-style files is described here.)

Timeline for d3drnb_: