| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Sulfolobus solfataricus [TaxId:2287] [188853] (4 PDB entries) |
| Domain d3drna_: 3drn A: [174208] automated match to d2a4va1 complexed with cit, gol |
PDB Entry: 3drn (more details), 2.15 Å
SCOPe Domain Sequences for d3drna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3drna_ c.47.1.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
vkvgdkaplfegiadngekislsdyigkhnivlyfypkddtpgstreasafrdnwdllkd
ydvvvigvssddinshkrfkekyklpfilvsdpdkkirelygakgfilparitfvidkkg
iirhiynsqmnpanhvnealkalkqikeeeis
Timeline for d3drna_: