Lineage for d3drdb_ (3drd B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131773Protein Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA [53438] (2 species)
    synonym: 7,8-diaminopelargonic acid synthase
  7. 2131774Species Bacillus subtilis [TaxId:1423] [188929] (2 PDB entries)
  8. 2131776Domain d3drdb_: 3drd B: [174207]
    automated match to d1s0aa_

Details for d3drdb_

PDB Entry: 3drd (more details), 2.17 Å

PDB Description: Crystal Structure of 7,8 Diaminopelargonic Acid Synthase Apoenzyme in Bacillus subtilis
PDB Compounds: (B:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase

SCOPe Domain Sequences for d3drdb_:

Sequence, based on SEQRES records: (download)

>d3drdb_ c.67.1.4 (B:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Bacillus subtilis [TaxId: 1423]}
thdliekskkhlwlpftqmkdydenpliiesgtgikvkdingkeyydgfssvwlnvhghr
kkelddaikkqlgkiahstllgmtnvpatqlaetlidispkkltrvfysdsgaeameial
kmafqywknigkpekqkfiamkngyhgdtigavsvgsielfhhvygplmfesykapipyv
yrsesgdpdecrdqclrelaqlleehheeiaalsiesmvqgasgmivmpegylagvrelc
ttydvlmivdevatgfgrtgkmfacehenvqpdlmaagkgitggylpiavtfatediyka
fyddyenlktffhghsytgnqlgcavalenlalfeseniveqvaekskklhfllqdlhal
phvgdirqlgfmcgaelvrsketkepypadrrigykvslkmrelgmltrplgdviaflpp
lastaeelsemvaimkqaihevtsle

Sequence, based on observed residues (ATOM records): (download)

>d3drdb_ c.67.1.4 (B:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Bacillus subtilis [TaxId: 1423]}
thdliekskkhlwlpftqmkdydenpliiesgtgikvkdingkeyydgfssvwlnvhghr
kkelddaikkqlgkiahstllgmtnvpatqlaetlidispkkltrvfysdsgaeameial
kmafqywknigkpekqkfiamksykapipyvyrsesgdpdecrdqclrelaqlleehhee
iaalsiesmvqgasgmivmpegylagvrelcttydvlmivdevatgfgrtgkmfacehen
vqpdlmaagkgitggylpiavtfatediykafyddyenlktffhghsytgnqlgcavale
nlalfeseniveqvaekskklhfllqdlhalphvgdirqlgfmcgaelvrsketkepypa
drrigykvslkmrelgmltrplgdviaflpplastaeelsemvaimkqaihevtsle

SCOPe Domain Coordinates for d3drdb_:

Click to download the PDB-style file with coordinates for d3drdb_.
(The format of our PDB-style files is described here.)

Timeline for d3drdb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3drda_