SCOPe 2.01: Domain d3dr9a_: 3dr9 A:

Lineage for d3dr9a_ (3dr9 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (16 PDB entries)

8. Domain d3dr9a_: 3dr9 A: [174204]
   automated match to d1ew6a_
   complexed with hem, so4

Details for d3dr9a_

PDB Entry: 3dr9, 1.26 Å

PDB Description: increased distal histidine conformational flexibility in the deoxy form of dehaloperoxidase from amphitrite ornata

PDB Compounds: (A:) Dehaloperoxidase A

SCOPe Domain Sequences for d3dr9a_:

Sequence; same for both SEQRES and ATOM records:

>d3dr9a_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d3dr9a_:

• d3dr9a_ is new in SCOPe 2.01-stable
  
• d3dr9a_ appears in SCOPe 2.02
  
• d3dr9a_ appears in the current release, SCOPe 2.08