Lineage for d3dr9a_ (3dr9 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1976528Protein Dehaloperoxidase [46530] (1 species)
  7. 1976529Species Amphitrite ornata [TaxId:129555] [46531] (31 PDB entries)
  8. 1976540Domain d3dr9a_: 3dr9 A: [174204]
    automated match to d1ew6a_
    complexed with hem, so4

Details for d3dr9a_

PDB Entry: 3dr9 (more details), 1.26 Å

PDB Description: increased distal histidine conformational flexibility in the deoxy form of dehaloperoxidase from amphitrite ornata
PDB Compounds: (A:) Dehaloperoxidase A

SCOPe Domain Sequences for d3dr9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dr9a_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d3dr9a_:

Click to download the PDB-style file with coordinates for d3dr9a_.
(The format of our PDB-style files is described here.)

Timeline for d3dr9a_: