SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3dr9a_ (3dr9 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1976528Protein Dehaloperoxidase [46530] (1 species)
  7. 1976529Species Amphitrite ornata [TaxId:129555] [46531] (31 PDB entries)
  8. 1976540Domain d3dr9a_: 3dr9 A: [174204]
    automated match to d1ew6a_
    complexed with hem, so4

Details for d3dr9a_

PDB Entry: 3dr9 (more details), 1.26 Å

PDB Description: Increased Distal Histidine Conformational Flexibility in the Deoxy Form of Dehaloperoxidase from Amphitrite ornata
PDB Compounds: (A:) Dehaloperoxidase A

SCOPe Domain Sequences for d3dr9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dr9a_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d3dr9a_:

Click to download the PDB-style file with coordinates for d3dr9a_.
(The format of our PDB-style files is described here.)

Timeline for d3dr9a_: