SCOPe 2.02: Domain d3dr6b_: 3dr6 B:

Lineage for d3dr6b_ (3dr6 B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein automated matches [190241] (10 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [188554] (2 PDB entries)

8. Domain d3dr6b_: 3dr6 B: [174200]
   automated match to d2bl1a1
   complexed with edo, gol

Details for d3dr6b_

PDB Entry: 3dr6, 1.75 Å

PDB Description: structure of ynca, a putative acetyltransferase from salmonella typhimurium

PDB Compounds: (B:) yncA

SCOPe Domain Sequences for d3dr6b_:

Sequence; same for both SEQRES and ATOM records:

>d3dr6b_ d.108.1.1 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
amtirfadkadcaaiteiynhavlhtaaiwndrtvdtdnrlawyearqllgypvlvseen
gvvtgyasfgdwrsfdgfrytvehsvyvhpahqgkglgrkllsrlidearrcgkhvmvag
iesqnaasirlhhslgftvtaqmpqvgvkfgrwldltfmqlqldehaap

Timeline for d3dr6b_:

• d3dr6b_ first appeared in SCOPe 2.01
  
• d3dr6b_ appears in SCOPe 2.03
  
• d3dr6b_ appears in the current release, SCOPe 2.08