Lineage for d1ycra_ (1ycr A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 538299Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 538300Superfamily a.42.1: SWIB/MDM2 domain [47592] (1 family) (S)
    binds to the transactivation domain of human p53
  5. 538301Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins)
    Pfam 02201
  6. 538308Protein MDM2 [47594] (2 species)
  7. 538312Species Human (Homo sapiens) [TaxId:9606] [47596] (2 PDB entries)
  8. 538316Domain d1ycra_: 1ycr A: [17420]

Details for d1ycra_

PDB Entry: 1ycr (more details), 2.6 Å

PDB Description: mdm2 bound to the transactivation domain of p53

SCOP Domain Sequences for d1ycra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycra_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens)}
etlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvv

SCOP Domain Coordinates for d1ycra_:

Click to download the PDB-style file with coordinates for d1ycra_.
(The format of our PDB-style files is described here.)

Timeline for d1ycra_: