Lineage for d1ycra_ (1ycr A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3574Fold a.42: MDM2 [47591] (1 superfamily)
  4. 3575Superfamily a.42.1: MDM2 [47592] (1 family) (S)
  5. 3576Family a.42.1.1: MDM2 [47593] (1 protein)
  6. 3577Protein MDM2 [47594] (2 species)
  7. 3580Species Human (Homo sapiens) [TaxId:9606] [47596] (1 PDB entry)
  8. 3581Domain d1ycra_: 1ycr A: [17420]

Details for d1ycra_

PDB Entry: 1ycr (more details), 2.6 Å

PDB Description: mdm2 bound to the transactivation domain of p53

SCOP Domain Sequences for d1ycra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycra_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens)}
etlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvv

SCOP Domain Coordinates for d1ycra_:

Click to download the PDB-style file with coordinates for d1ycra_.
(The format of our PDB-style files is described here.)

Timeline for d1ycra_: